CookSnap is coming soon — Join the waitlist →

Walnut & Sour Cherry Strudel with Tea

Crispy phyllo wrapped around tart sour cherries and toasted walnuts, dusted with cinnamon—a Hungarian classic ready in under 30 minutes. Serve warm with tea for the full cozy vibe.

Total time
28 min
Servings
4
Calories
285
Protein
6g
Walnut & Sour Cherry Strudel with Tea
cozynostalgichungarianvegetariancrispyflakycrunchyweeknight

Ingredients

  • 6 sheets phyllo dough sheets
  • 4 tbsp butter, melted
  • 1.5 cups sour cherries (canned or frozen), drained
  • ¾ cup walnuts, finely chopped
  • 3 tbsp granulated sugar
  • ½ tsp ground cinnamon
  • ½ tsp lemon zest
  • ¼ cup water or strong brewed tea

Instructions

  1. 1

    Preheat oven to 375°F. Mix cherries, walnuts, sugar, cinnamon, and lemon zest in a bowl.

  2. 2

    Lay one phyllo sheet on a work surface, brush lightly with melted butter.

  3. 3

    Layer remaining phyllo sheets on top, brushing each with butter until all are stacked.

  4. 4

    Spread cherry-walnut mixture in a line 2 inches from the edge, leaving 1-inch margins on sides.

  5. 5

    Roll tightly from the filled edge, tuck in sides, place seam-side down on a buttered sheet pan.

  6. 6

    Brush the roll with remaining butter, pour water around the pan, bake 18–20 min until golden.

Tools you’ll need

  • 9x13-inch sheet pan
  • medium bowl
  • pastry brush
  • cutting board
  • sharp knife
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.