CookSnap is coming soon — Join the waitlist →

Vietnamese Lemongrass Chicken Bowl

Pan-seared lemongrass chicken over jasmine rice with pickled carrots, fresh herbs, and a bright lime-fish sauce drizzle. Ready in 25 minutes.

Total time
25 min
Servings
2
Calories
520
Protein
42g
Vietnamese Lemongrass Chicken Bowl
freshlightvietnamesechickencrispytenderweeknightbowl

Ingredients

  • 1 lb boneless, skinless chicken breasts
  • 3 stalks lemongrass stalks, minced
  • 1.5 cups shredded carrots
  • 3 tbsp white vinegar
  • 2 tbsp fish sauce
  • 2 limes limes (juiced)
  • 2 cups jasmine rice, cooked
  • ½ cup fresh herbs (mint, cilantro, basil), chopped

Instructions

  1. 1

    Toss shredded carrots with white vinegar and a pinch of salt. Set aside to quick-pickle while you cook.

  2. 2

    Pat chicken dry. Mix minced lemongrass with 1 tbsp salt and coat both sides generously.

  3. 3

    Heat oil in a 12-inch skillet over medium-high until shimmering, about 90 seconds.

  4. 4

    Sear chicken 6–7 minutes per side without moving. Edges should look golden; internal temp 165°F.

  5. 5

    Whisk fish sauce with lime juice and 2 tbsp water. Slice cooked chicken and drizzle with sauce.

  6. 6

    Divide rice between bowls. Top with sliced chicken, pickled carrots, and fresh herbs. Serve immediately.

Tools you’ll need

  • 12-inch skillet
  • cutting board
  • knife
  • small bowl
  • whisk
  • serving spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.