CookSnap is coming soon — Join the waitlist →
Back to recipes

Vietnamese Chicken Noodle Salad

Fresh rice noodles, shredded chicken, and crisp vegetables tossed in a tangy lime-fish sauce dressing. Ready in 20 minutes with bright, herbaceous flavors.

Total time
20 min
Servings
2
Calories
420
Protein
32g
Vietnamese Chicken Noodle Salad
freshlightvietnamesechickentendercrispweeknightlunch

Ingredients

  • 8 oz cooked chicken breast, shredded
  • 4 oz rice noodles (dried)
  • 1 whole cucumber
  • 2 whole carrots
  • 1 whole lime
  • 2 tbsp fish sauce
  • ½ cup fresh mint and cilantro, chopped
  • ¼ cup peanuts, crushed

Instructions

  1. 1

    Boil salted water in a pot. Add rice noodles, stir, and cook until tender, ~4 minutes.

  2. 2

    Drain noodles and rinse with cold water until cool. Set aside.

  3. 3

    Peel carrots and cut into thin 2-inch matchsticks.

  4. 4

    Cut cucumber in half lengthwise, scoop seeds, then slice into thin half-moons.

  5. 5

    Whisk lime juice with fish sauce and 1 tbsp water until combined.

  6. 6

    Toss noodles, chicken, carrots, and cucumber in a bowl with the dressing.

  7. 7

    Top with fresh mint, cilantro, and crushed peanuts. Serve immediately.

Tools you’ll need

  • medium pot
  • colander
  • cutting board
  • chef's knife
  • small bowl
  • whisk
  • large mixing bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.