CookSnap is coming soon — Join the waitlist →
Back to recipes

Vietnamese Chicken Noodle Salad

Cool, tangy rice noodles with shredded chicken, fresh herbs, and a punchy lime-fish sauce dressing. Ready in 20 minutes.

Total time
20 min
Servings
4
Calories
285
Protein
22g
Vietnamese Chicken Noodle Salad
freshlightvietnamesechickentenderchewyweeknightlunch

Ingredients

  • 12 oz cooked shredded chicken
  • 6 oz rice noodles (8 mm width)
  • 1 medium cucumber
  • 2 medium carrots
  • 1 cup fresh mint and cilantro, packed
  • 3 tbsp lime juice
  • 2 tbsp fish sauce
  • 1 tsp sugar

Instructions

  1. 1

    Boil water in a large pot. Add rice noodles and cook until tender, about 8 minutes. Drain and rinse under cold water until cool.

  2. 2

    Julienne the carrots into thin matchsticks. Slice the cucumber into thin rounds.

  3. 3

    Stir together lime juice, fish sauce, and sugar in a small bowl until sugar dissolves.

  4. 4

    Place cooled noodles in a large bowl. Add chicken, carrots, cucumber, and half the herbs.

  5. 5

    Pour dressing over the salad and toss until evenly coated.

  6. 6

    Divide among bowls and top with remaining fresh herbs. Serve cold.

Tools you’ll need

  • large pot
  • colander
  • vegetable peeler or mandoline
  • small mixing bowl
  • large mixing bowl
  • serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.