Custrd is out on the App Store — Download it free →
Back to recipes

Udon Soup

A comforting bowl of thick udon noodles in a savory broth, topped with fish cake, daikon, and green onion. Simple and satisfying for a weeknight dinner.

Total time
25 min
Servings
2
Calories
420
Protein
18g
Udon Soup
comfortingcozyJapanesedairy-freefishchewytenderweeknight

Ingredients

  • 2 servings udon noodles
  • 4 cups dashi stock
  • 3 tbsp soy sauce
  • 2 tbsp mirin
  • 4 oz daikon radish
  • 4 oz fish cake (kamaboko)
  • 2 stalks green onions

Instructions

  1. 1

    Peel the 4 oz daikon and slice into 1/4-inch rounds, then cut the 4 oz fish cake into thin slices. Slice the 2 green onions diagonally into 1-inch pieces.

  2. 2

    In a pot, bring 4 cups dashi stock to a boil over medium-high heat. Add the 3 tbsp soy sauce and 2 tbsp mirin, stirring to combine.

  3. 3

    Add the daikon slices to the broth and simmer over medium heat until tender, about 10 minutes. The daikon should be easily pierced with a fork.

  4. 4

    Add the 2 servings udon noodles and the fish cake slices to the pot. Cook until the noodles are heated through and separated, about 3-4 minutes, stirring gently.

  5. 5

    Ladle the soup into bowls, making sure each gets noodles, daikon, and fish cake. Top with the sliced green onions and serve hot.

Tools you’ll need

  • pot
  • knife
  • cutting board
  • ladle

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.