CookSnap is coming soon — Join the waitlist →

Tarte Tropézienne

A showstopping French pastry with crispy choux bun filled with rich cream and topped with toasted coconut. Impressive enough for guests but doable in one afternoon.

Total time
55 min
Servings
8
Calories
385
Protein
6g
Tarte Tropézienne
elegantindulgentfrenchvegetariancrispycreamyfluffyweekend

Ingredients

  • ½ cup butter
  • 1 cup water
  • 1 cup all-purpose flour
  • 4 large eggs
  • ¼ tsp salt
  • 1.5 cups heavy cream
  • ¾ cup sweetened shredded coconut
  • 3 tbsp granulated sugar
  • 1 tsp vanilla extract
  • 2 tbsp confectioners sugar

Instructions

  1. 1

    Heat butter and water in a medium saucepan over medium heat until butter melts and mixture boils.

  2. 2

    Remove from heat. Add flour and salt, stirring vigorously until mixture forms a ball.

  3. 3

    Let dough cool 2 minutes. Add eggs one at a time, beating well after each until fully incorporated.

  4. 4

    Preheat oven to 400°F. Pipe dough into an 8-inch ring on a parchment-lined baking sheet.

  5. 5

    Bake 35–40 minutes until golden brown and puffed. Cool completely on a wire rack.

  6. 6

    Toast coconut in a dry skillet over medium heat, stirring often, until golden, ~4 minutes.

  7. 7

    Whip cold cream, granulated sugar, and vanilla until stiff peaks form, ~2 minutes.

  8. 8

    Slice cooled choux ring horizontally. Spread cream on bottom half, cover with top.

  9. 9

    Dust with confectioners sugar. Press toasted coconut onto sides and top, pressing gently.

  10. 10

    Chill 15 minutes before serving. Slice into 8 wedges with a hot, damp knife.

Tools you’ll need

  • medium saucepan
  • wooden spoon
  • piping bag with large round tip
  • baking sheet
  • parchment paper
  • wire rack
  • 12-inch skillet
  • wooden spoon for toasting
  • electric mixer or whisk
  • serrated knife
  • pastry brush or fork (optional, for pressing coconut)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.