CookSnap is coming soon — Join the waitlist →
Back to recipes

Tapioca de Frango

A beloved Brazilian street food: crispy tapioca crepes filled with shredded chicken, onions, and fresh cilantro. Naturally gluten-free and ready in under 40 minutes.

Total time
35 min
Servings
4
Calories
320
Protein
28g
Tapioca de Frango
casualsimplebraziliangluten-freechickencrispytenderweeknight

Ingredients

  • 1 pound chicken breast, boneless and skinless
  • 1 cup tapioca starch (goma de tapioca)
  • 1 medium yellow onion
  • ¼ cup fresh cilantro
  • ½ whole lime
  • 3 tablespoons olive oil
  • 1 teaspoon salt
  • ¼ teaspoon black pepper

Instructions

  1. 1

    Place the chicken breast in a pot, cover with water by 2 inches, and bring to a boil over high heat. Once boiling, reduce heat to medium-low and simmer for 12–15 minutes, until the thickest part reaches 165°F on an instant-read thermometer.

  2. 2

    Remove the chicken from the pot using tongs and place it on a cutting board. Let it cool for 2 minutes, then shred it into bite-sized pieces using two forks pulling in opposite directions.

  3. 3

    Cut the onion in half from root to tip, then place cut-side down and slice lengthwise into thin half-moons about 1/8-inch thick.

  4. 4

    Chop the cilantro leaves and tender stems until you have a small mound that fills about 1/4 cup when lightly packed.

  5. 5

    Squeeze the lime juice into a small bowl — you should have about 1 tablespoon of juice.

  6. 6

    Heat 1 tablespoon of olive oil in a large skillet over medium-high heat until it shimmers and slides quickly when you tilt the pan, about 60 seconds.

  7. 7

    Add the sliced onion to the hot oil and stir every 15 seconds for 3–4 minutes, until the onion turns light golden and smells sweet.

  8. 8

    Add the shredded chicken, the lime juice, 1 teaspoon of salt, and the black pepper. Stir continuously for 1 minute until the chicken is warm and evenly coated.

  9. 9

    Remove the skillet from heat and stir in the cilantro. Taste and adjust salt if needed — the filling should taste savory and bright.

  10. 10

    Pour the tapioca starch into a shallow bowl or wide dish.

  11. 11

    Wipe out the skillet with a paper towel and set it back on the stove over medium-high heat. Add the remaining 2 tablespoons of olive oil and wait until it shimmers, about 60 seconds.

  12. 12

    Scoop about 3 tablespoons of tapioca starch into the hot oil, forming a loose, flat mound. Using the back of a spoon, gently press and spread it into a thin, uneven circle about 4–5 inches across, leaving a rougher texture (not smooth).

  13. 13

    Let the tapioca cook without moving it for 1–2 minutes until the bottom is set and light golden, then gently flip it using a spatula and cook the other side for 30–45 seconds until it looks crispy with light golden spots.

  14. 14

    Slide the tapioca crepe onto a plate. While still hot and pliable, place about 2–3 tablespoons of the chicken filling in the center, then fold the crepe in half like a half-moon.

  15. 15

    Repeat steps 12–14 with the remaining tapioca starch and filling until you have made 8 tapioca crepes total, adding oil to the skillet as needed.

Tools you’ll need

  • pot with lid (4-quart or larger)
  • instant-read thermometer
  • cutting board
  • chef's knife
  • two forks
  • small bowl
  • 12-inch skillet or larger
  • wooden spoon
  • shallow dish or wide bowl
  • spoon for pressing and shaping
  • spatula
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.