CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Tallarines Verdes con Pollo

Creamy green pasta with tender chicken in a vibrant basil-spinach sauce. A Peruvian classic that comes together in one pan in under 30 minutes.

Total time
28 min
Servings
2
Calories
620
Protein
42g
Tallarines Verdes con Pollo
comfortfreshperuvianchickencreamytenderweeknightpasta

Ingredients

  • ¾ lb boneless skinless chicken breasts
  • 2 cups fresh spinach
  • ½ cup fresh basil
  • 8 oz spaghetti or fettuccine
  • ¾ cup heavy cream
  • 3 cloves garlic, minced

Instructions

  1. 1

    Place each chicken breast flat on a cutting board and slice horizontally through the middle to create two thin, even pieces about 1/2-inch thick.

  2. 2

    Mince the garlic until the pieces are smaller than a grain of rice—about pencil-tip size—so it cooks quickly and distributes evenly through the sauce.

  3. 3

    Measure the spinach into a pile on the cutting board and roughly chop it into 2-inch pieces; do the same with the basil, keeping the two piles separate.

  4. 4

    Fill a large pot with water, add a pinch of salt, and bring to a boil over high heat; this should take about 6 minutes. You'll see large rolling bubbles breaking the surface.

  5. 5

    While the water heats, warm 2 tablespoons of olive oil in a large skillet over medium-high heat for about 90 seconds until it shimmers and moves quickly when you tilt the pan.

  6. 6

    Add the minced garlic to the hot oil and stir constantly for 30 seconds until the kitchen smells strongly fragrant—this wakes up the garlic's flavor.

  7. 7

    Place the thin chicken pieces flat in the skillet in a single layer and cook without moving for 3 minutes until the bottom surface turns opaque and pale golden.

  8. 8

    Flip each chicken piece over with a spatula and cook the other side for 2 more minutes until the entire surface is opaque (no pink showing).

  9. 9

    Remove the skillet from heat and pour in 0.75 cup of heavy cream, stirring gently to coat the chicken and create a creamy base.

  10. 10

    Add all the chopped spinach and basil to the skillet in a mound on top of the cream and chicken, then stir everything together for 1 minute until the greens wilt and blend into a thick green sauce.

  11. 11

    When the boiling water reaches a rolling boil, add 8 oz of dried pasta and stir it immediately so the strands separate and cook evenly for 8 to 10 minutes until it bends easily but still has a slight firmness when you bite it.

  12. 12

    Drain the cooked pasta in a colander, shaking gently to remove excess water, then add it to the skillet with the green sauce and chicken.

  13. 13

    Stir the pasta and sauce together over low heat for 1 minute until the noodles are evenly coated and the entire dish looks creamy and green.

  14. 14

    Taste a bite and add salt and pepper until it tastes well-seasoned—start with a pinch of each and add more if needed.

  15. 15

    Divide the pasta and chicken between two bowls or plates, spooning equal amounts of the creamy green sauce over each portion.

Tools you’ll need

  • large pot
  • large skillet (12-inch preferred)
  • colander
  • cutting board
  • chef's knife
  • wooden spoon or rubber spatula
  • tongs or kitchen spoon
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.