CookSnap is coming soon — Join the waitlist →
Back to recipes

Giant Crispy Taiwanese Fried Chicken

Paper-thin pounded chicken breast, seasoned and fried golden until shattering-crispy on the outside and juicy within. Ready in 25 minutes with proper oil temperature control.

Total time
25 min
Servings
2
Calories
520
Protein
42g
Giant Crispy Taiwanese Fried Chicken
satisfyingsimpletaiwanesechickencrispyjuicysnackweeknight

Ingredients

  • 2 large (about 8 oz each) boneless, skinless chicken breasts
  • ¾ cup all-purpose flour
  • ¼ cup cornstarch
  • 1 tsp salt
  • ½ tsp white pepper
  • 1.5 cups neutral cooking oil (vegetable or canola)

Instructions

  1. 1

    Place chicken on a cutting board. Slice each breast horizontally in half, creating two thinner cutlets.

  2. 2

    Pound cutlets between plastic wrap to 1/4-inch thickness using a meat mallet with steady, even strikes.

  3. 3

    Mix flour, cornstarch, salt, and white pepper in a shallow bowl. Pat cutlets dry, then coat both sides evenly.

  4. 4

    Heat oil in a 12-inch skillet to exactly 350°F (use a thermometer). Oil should shimmer and a flour pinch should bubble immediately.

  5. 5

    Carefully slide one cutlet into oil. Fry without moving for 3–4 minutes until bottom is deep golden brown.

  6. 6

    Flip once and fry the other side 2–3 minutes until edges curl and coating shatters when pressed lightly.

  7. 7

    Transfer to a paper-towel-lined plate. Repeat with second cutlet. Serve hot while crust is still crackling.

Tools you’ll need

  • cutting board
  • meat mallet
  • plastic wrap
  • shallow bowl
  • 12-inch skillet
  • instant-read thermometer
  • paper towels
  • slotted spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.