Custrd is out on the App Store — Download it free →
Back to recipes

Tahini Beef Kebab with Grilled Rice

Seasoned ground beef skewers with a charred crust, served alongside crispy grilled rice and creamy tahini sauce. Ready in under 30 minutes — Israeli street food that tastes like a fancy dinner.

Total time
25 min
Servings
2
Calories
540
Protein
32g
Tahini Beef Kebab with Grilled Rice
satisfyingcasualisraelibeefcrispytendercreamyweeknight

Ingredients

  • ¾ lb ground beef
  • 1.5 cups cooked white rice, cooled and pressed into patties
  • ⅓ cup tahini
  • 1 whole lemon (zested + juiced)
  • 1 tsp cumin
  • ¼ cup red onion, minced
  • ¼ cup fresh parsley or cilantro, chopped

Instructions

  1. 1

    Mix ground beef, minced red onion, cumin, lemon zest, salt, and pepper in a bowl until just combined.

  2. 2

    Divide meat into 4 portions and mold onto skewers or into patties. Heat oil in a skillet over medium-high until it shimmers.

  3. 3

    Sear kebabs 3–4 minutes per side without moving. Crust should look dark brown; meat stays juicy inside.

  4. 4

    Remove kebabs. In the same skillet, press rice patties flat and sear 2 minutes per side until golden and crispy.

  5. 5

    Whisk tahini with lemon juice, 3 tbsp water, minced garlic, and salt until pourable. Taste and adjust.

  6. 6

    Plate rice, top with kebabs, drizzle tahini sauce, and scatter fresh parsley over top. Serve hot.

Tools you’ll need

  • large mixing bowl
  • 12-inch skillet or grill pan
  • metal skewers or meat molds
  • whisk
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.