CookSnap is coming soon — Join the waitlist →
Back to recipes

Tacu Tacu: Peruvian Beef & Potato Cake

Crispy pan-fried potato and beef patty with a spiced tomato sauce — a beloved Peruvian street food that transforms leftover rice and steak into something irresistible.

Total time
45 min
Servings
2
Calories
520
Protein
28g
Tacu Tacu: Peruvian Beef & Potato Cake
comfortcasualperuvianbeefcrispytenderweeknightmain-dish

Ingredients

  • ½ lb ground beef
  • 1 lb russet potatoes
  • ½ medium white onion
  • 2 cloves garlic cloves
  • ¾ cup canned crushed tomatoes
  • 3 tablespoon olive oil
  • ½ teaspoon cumin
  • 1 to taste salt and pepper

Instructions

  1. 1

    Scrub the potatoes under cold running water to remove dirt, then cut them in half lengthwise. Place them cut-side down on a cutting board and slice crosswise into 1/4-inch-thick half-moons.

  2. 2

    Fill a medium pot with water, add a pinch of salt, and bring to a boil over high heat until you see large rolling bubbles breaking the surface, about 8 minutes.

  3. 3

    Add the potato slices to the boiling water and cook, stirring once every minute, until a fork slides through the thickest piece with no resistance, about 12 minutes.

  4. 4

    Drain the potatoes in a colander and spread them on a paper towel to cool and dry, about 5 minutes.

  5. 5

    Cut the onion from root to tip into 1/4-inch-thick slices, then chop them into pieces roughly the size of a pea.

  6. 6

    Mince the garlic until the pieces are smaller than a grain of rice — about pencil-tip-dot size.

  7. 7

    Heat 1 tablespoon of olive oil in a 10-inch skillet over medium heat until it shimmers and slides quickly when you tilt the pan, about 45 seconds.

  8. 8

    Add the diced onion and cook, stirring once every 15 seconds, until it turns translucent and smells sweet, about 3 minutes.

  9. 9

    Add the minced garlic and cook, stirring constantly, until the smell becomes strong and fragrant, about 30 seconds.

  10. 10

    Stir in the cumin, then pour in 3/4 cup of crushed tomatoes and stir until everything is evenly mixed.

  11. 11

    Reduce heat to low and simmer, stirring once every minute, until the sauce darkens and thickens to the consistency of ketchup, about 8 minutes.

  12. 12

    Season the sauce with salt and pepper by adding a small pinch of each, stirring, tasting, and repeating until it tastes balanced to you.

  13. 13

    Transfer the sauce to a small bowl and set aside on the counter.

  14. 14

    Return the skillet to medium heat and add 2 tablespoons of olive oil, tilting the pan to coat the bottom evenly.

  15. 15

    Crumble the ground beef directly into the hot oil, breaking it apart with a wooden spoon into pea-sized pieces as it cooks, stirring once every 20 seconds until no pink remains, about 6 minutes.

  16. 16

    Add the cooked potato slices to the beef and stir gently to mix, pressing down occasionally with the back of your spoon to help potatoes and beef stick together, about 2 minutes.

  17. 17

    Without stirring, press the mixture firmly against the bottom of the skillet with a spatula to form one large flat cake, then let it cook undisturbed over medium-high heat until the underside turns golden brown, about 5 minutes.

  18. 18

    Slide the tacu tacu onto a cutting board, then slide it back into the skillet with the golden side facing up and cook undisturbed until the second side is golden brown, about 4 minutes.

  19. 19

    Slide the tacu tacu onto a serving plate and top with the reserved tomato sauce, spooning it over the center and letting it run down the sides.

Tools you’ll need

  • colander
  • cutting board
  • chef's knife
  • medium pot
  • 10-inch skillet
  • wooden spoon
  • rubber spatula
  • small bowl
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.