CookSnap is coming soon — Join the waitlist →
Back to recipes

Stargazy Pie

A striking British seafood pie where whole sardines or small fish peek through a golden pastry crust, their heads pointing toward the sky. Buttery, flaky, and surprisingly simple to assemble.

Total time
45 min
Servings
4
Calories
385
Protein
24g
Stargazy Pie
elegantrusticbritishfishflakytendercrispyweekend

Ingredients

  • 1.5 cups all-purpose flour
  • 6 tablespoons cold butter, cubed
  • ½ teaspoon salt
  • 4 tablespoons ice water
  • 8 whole fish fresh sardines or small mackerel, gutted and cleaned
  • 2 tablespoons fresh parsley, chopped

Instructions

  1. 1

    Pour 1.5 cups flour and 0.5 teaspoon salt into a large mixing bowl and stir with a fork to combine.

  2. 2

    Add 6 tablespoons of cold, cubed butter to the flour and use your fingertips to rub the butter into the flour until the mixture looks like coarse breadcrumbs or sand.

  3. 3

    Pour 4 tablespoons of ice water over the flour mixture and stir gently with a fork until the dough just comes together into a shaggy ball; do not overmix.

  4. 4

    Wrap the dough ball in plastic wrap and place it in the refrigerator for 15 minutes while you prepare the fish.

  5. 5

    Set the oven to 400°F and wait until the indicator light or beep tells you it has finished heating, about 10 minutes.

  6. 6

    Remove the dough from the refrigerator and roll it out on a lightly floured surface into a circle about 1/4 inch thick, roughly the size of your 9-inch pie dish.

  7. 7

    Lay the rolled dough into a 9-inch pie dish, letting any excess hang over the edge; do not trim it yet.

  8. 8

    Arrange the 8 cleaned fish on the dough in a circular pattern with their tails toward the center and their heads pointing outward and upward, so the heads poke through the crust.

  9. 9

    Sprinkle 2 tablespoons of chopped parsley evenly over the fish, then fold the overhanging dough edges up and over the fish, pressing gently so the crust partially covers the tails and sides.

  10. 10

    Place the pie dish in the preheated 400°F oven and bake for 20 to 25 minutes, until the pastry is golden brown and the fish skin looks opaque, not translucent.

  11. 11

    Remove the pie from the oven and let it rest for 3 minutes, then slice and serve warm.

Tools you’ll need

  • large mixing bowl
  • fork
  • 9-inch pie dish
  • rolling pin
  • plastic wrap
  • chef's knife
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.