CookSnap is coming soon — Join the waitlist →

Spanish Tuna & Egg Salad

Crisp lettuce, tender eggs, buttery tuna, and briny olives tossed in a punchy sherry vinaigrette. The ultimate 15-minute Spanish lunch that tastes like a tapas bar on a plate.

Total time
15 min
Servings
2
Calories
380
Protein
28g
Spanish Tuna & Egg Salad
freshcasualspanishvegetarianeggscrispytenderweeknight

Ingredients

  • 5 cups romaine or mixed greens
  • 2 whole large eggs
  • 5 oz canned tuna in oil
  • ½ cup Castelvetrano olives or green olives, pitted
  • ¼ medium red onion
  • 2 tbsp sherry vinegar
  • 3 tbsp extra-virgin olive oil

Instructions

  1. 1

    Bring a small pot of salted water to a boil. Add eggs and cook for 7 minutes until hard-boiled.

  2. 2

    While eggs cook, whisk sherry vinegar, olive oil, and a pinch of salt and pepper in a small bowl.

  3. 3

    Thinly slice the red onion. Tear or chop the greens into bite-size pieces.

  4. 4

    Transfer greens and onion to a serving bowl or platter. Drain tuna, break it into chunks, and scatter over the greens with the olives.

  5. 5

    Peel and quarter the cooled eggs. Arrange them on top of the salad.

  6. 6

    Pour the vinaigrette over the salad and toss gently. Serve immediately.

Tools you’ll need

  • small pot
  • small bowl
  • whisk
  • cutting board
  • knife
  • serving bowl or platter

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.