CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Southern Fried Okra

Crispy, golden okra fried until the outside crackles and the inside stays tender. A classic Southern side that's irresistible hot from the pan.

Total time
20 min
Servings
4
Calories
285
Protein
3g
Southern Fried Okra
comfortcasualsouthernvegetariancrispytenderweeknightbbq

Ingredients

  • 1 lb fresh okra
  • ¾ cup cornmeal
  • ½ cup all-purpose flour
  • 1 teaspoon salt
  • ½ teaspoon black pepper
  • 2 cups vegetable oil for frying

Instructions

  1. 1

    Rinse the okra under cold water and pat it completely dry with paper towels — moisture is the enemy of crispiness.

  2. 2

    Trim the stem end of each okra pod by cutting off the very top, about 1/4 inch, with a paring knife in one straight cut.

  3. 3

    Pour the cornmeal and flour into a medium bowl and stir them together with a fork until well combined and uniform.

  4. 4

    Add 1 teaspoon salt and 0.5 teaspoon black pepper to the cornmeal mixture and stir with the fork until the seasoning is evenly distributed.

  5. 5

    Pour 2 cups vegetable oil into a large skillet and heat over medium-high heat until the oil shimmers and a single okra pod sizzles immediately when dropped in, about 3–4 minutes.

  6. 6

    Add about one-third of the okra to the cornmeal mixture and shake the bowl gently to coat each piece on all sides with an even layer of cornmeal.

  7. 7

    Carefully slide the coated okra from the bowl into the hot oil, using a slotted spoon or fork so excess cornmeal stays in the bowl.

  8. 8

    Fry, stirring gently with a slotted spoon once every 30 seconds, until the okra is golden brown all over and the coating looks crispy, about 3–4 minutes total.

  9. 9

    Use the slotted spoon to scoop the fried okra out of the oil and onto a plate lined with paper towels to drain.

  10. 10

    Repeat steps 6–9 with the remaining two batches of okra, allowing the oil temperature to recover between batches, about 1 minute each time.

  11. 11

    Once all the okra is fried and drained, taste a piece and add extra salt and pepper to the pile if you prefer — serve hot.

Tools you’ll need

  • large skillet (12-inch)
  • medium mixing bowl
  • fork
  • paring knife
  • cutting board
  • paper towels
  • slotted spoon
  • instant-read thermometer (optional)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.