CookSnap is coming soon — Join the waitlist →
Back to recipes

Southern Buttermilk Fried Chicken Biscuit

Crispy fried chicken thighs tucked into warm buttermilk biscuits with a touch of hot honey and tangy pickles. Restaurant-quality sandwich in under 30 minutes.

Total time
25 min
Servings
2
Calories
520
Protein
38g
Southern Buttermilk Fried Chicken Biscuit
comfortindulgentsouthernchickencrispytenderflakyweeknight

Ingredients

  • ¾ cup buttermilk
  • 2 pieces (about 12 oz total) chicken thighs, boneless and skinless
  • ¾ cup all-purpose flour
  • 1 tsp salt
  • ½ tsp black pepper
  • 2 tbsp vegetable oil
  • 2 pieces buttermilk biscuits (from deli or frozen, pre-baked)
  • 2 tbsp hot honey (mix 2 tbsp honey + 0.25 tsp cayenne)
  • 4 slices dill pickle slices

Instructions

  1. 1

    Pat chicken thighs dry with paper towels. Season all over with salt and pepper.

  2. 2

    Pour buttermilk into a shallow bowl. Mix flour, salt, and pepper in another bowl.

  3. 3

    Dip each chicken thigh into buttermilk, then coat both sides thoroughly with seasoned flour.

  4. 4

    Heat oil in a 10-inch skillet over medium-high until it shimmers, about 90 seconds.

  5. 5

    Sear chicken 5–6 minutes per side without moving. Edges should turn deep golden and no pink remains inside.

  6. 6

    Transfer chicken to a plate lined with paper towels to drain. Warm biscuits in the skillet 30 seconds per side.

  7. 7

    Split each warm biscuit in half. Drizzle cut sides with hot honey.

  8. 8

    Layer one chicken thigh and 2 pickle slices on the bottom half of each biscuit. Top with the other half.

  9. 9

    Serve immediately while chicken and biscuits are still warm.

Tools you’ll need

  • 10-inch skillet (cast iron preferred)
  • two shallow bowls
  • paper towels
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.