CookSnap is coming soon — Join the waitlist →
Back to recipes

Simple Ramen Upgrade

Take instant ramen from plain to impressive with a soft-boiled egg, quick-pickled vegetables, and a silky broth enriched with miso and sesame oil. Total time under 20 minutes.

Total time
18 min
Servings
2
Calories
385
Protein
14g
Simple Ramen Upgrade
comfortsimplejapanesevegetarianeggscreamytenderweeknight

Ingredients

  • 4 cups water
  • 2 packages instant ramen noodles (2 packages, seasoning packets reserved)
  • 2 tbsp white miso paste
  • 1 tbsp sesame oil
  • 2 whole eggs
  • ½ whole cucumber, thinly sliced
  • 2 tbsp rice vinegar
  • 2 tbsp scallions, chopped (or fresh herbs)

Instructions

  1. 1

    Bring water to a boil in a pot over high heat.

  2. 2

    Once boiling, gently lower eggs into water. Boil for 6 minutes for soft yolks.

  3. 3

    While eggs cook, toss cucumber slices with rice vinegar and a pinch of salt.

  4. 4

    Remove eggs to an ice bath. Let sit 2 minutes, then peel and set aside.

  5. 5

    Return water to boil. Add noodles and cook per package directions, usually 3 minutes.

  6. 6

    While noodles cook, whisk miso paste with 2 tbsp warm water until smooth.

  7. 7

    Remove pot from heat. Stir in miso mixture and sesame oil until combined.

  8. 8

    Divide noodles and broth between two bowls. Top each with one halved egg.

  9. 9

    Add pickled cucumber, scallions, and reserved seasoning packet to taste.

  10. 10

    Serve immediately while broth is still hot.

Tools you’ll need

  • large pot (3-quart minimum)
  • small bowl
  • whisk
  • slotted spoon
  • small plate or bowl for ice bath
  • vegetable knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.