Custrd is out on the App Store — Download it free →
Back to recipes

Sicilian-style Thick Crust Pizza

A thick, fluffy Sicilian-style pizza topped with tomato sauce, mozzarella, anchovies, onions, bell peppers, olives, and pepperoni. Ready in about 20 minutes using pre-made dough.

Total time
25 min
Servings
4
Calories
480
Protein
22g
Sicilian-style Thick Crust Pizza
comfortingItaliananchovycheesechewycrispyweeknightpizza

Ingredients

  • 1 lb pizza dough
  • 1 cup tomato sauce
  • 2 cups shredded mozzarella
  • 6 fillets anchovy fillets
  • 1 medium red onion
  • 1 medium bell pepper

Instructions

  1. 1

    Preheat oven to 475°F. Press the 1 lb pizza dough into a lightly oiled 9x13-inch baking sheet, stretching to the edges. Let rest while you prep toppings, about 5 minutes.

  2. 2

    Spread 1 cup tomato sauce evenly over the dough, leaving a 1/2-inch border. Sprinkle 2 cups shredded mozzarella over the sauce.

  3. 3

    Scatter 1 sliced red onion, 1 sliced bell pepper, 6 anchovy fillets, and optional pepperoni and olives over the cheese.

  4. 4

    Bake until the crust is golden and the cheese is bubbly and browned in spots, about 15-18 minutes. Let cool 2 minutes before slicing.

  5. 5

    Slice and serve hot.

Tools you’ll need

  • 9x13-inch baking sheet
  • oven
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.