CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Shrimp Youvetsi with Orzo

Sheet-pan shrimp and orzo baked in garlicky tomato sauce with feta. The kind of one-pan Greek dinner that tastes like you spent hours but takes less than 20 minutes.

Total time
18 min
Servings
2
Calories
468
Protein
42g
20-Min Shrimp Youvetsi with Orzo
comfortquickgreekshrimptendercreamyweeknightpasta

Ingredients

  • 1 lb shrimp, peeled and deveined
  • 1 cup orzo pasta
  • 1.5 cans (14.5 oz each) crushed tomatoes
  • ½ cup crumbled feta cheese
  • 4 cloves garlic, minced
  • 1 whole lemon (zested and juiced)

Instructions

  1. 1

    Preheat oven to 425°F. Add orzo, crushed tomatoes, garlic, lemon zest, 1.5 cups water, and a pinch of salt to a 9x13-inch baking dish.

  2. 2

    Bake orzo for 8 minutes until it starts to soften, stirring once halfway through.

  3. 3

    Pat shrimp dry with paper towels. Toss with salt, pepper, and olive oil.

  4. 4

    Remove baking dish from oven. Stir the orzo, then nestle shrimp into the sauce in a single layer.

  5. 5

    Bake for 6–7 minutes until shrimp turn opaque and the liquid is mostly absorbed.

  6. 6

    Remove from oven, scatter feta over the top, and squeeze lemon juice over everything. Serve hot.

Tools you’ll need

  • 9x13-inch baking dish
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Greek recipes →