Custrd is out on the App Store — Download it free →
Back to recipes

Shrimp Vatapa

A creamy Brazilian shrimp stew with a rich, yellow coconut sauce, finished with fresh parsley. Quick enough for a weeknight but special enough for company.

Total time
30 min
Servings
4
Calories
380
Protein
28g
Shrimp Vatapa
comfortingexoticBraziliangluten-freeshrimpcreamytenderweeknight

Ingredients

  • 1 lb shrimp, peeled and deveined
  • 1 medium onion, chopped
  • 3 cloves garlic, minced
  • 1 can (13.5 oz) coconut milk
  • 2 tbsp tomato paste
  • 2 tbsp peanut butter
  • 2 tbsp olive oil
  • 2 tbsp fresh parsley, chopped

Instructions

  1. 1

    Season the 1 lb shrimp with salt and pepper. Heat 2 tbsp olive oil in a large skillet over medium-high heat. Add shrimp in a single layer and cook until pink and opaque, about 2 minutes per side. Remove and set aside.

  2. 2

    In the same skillet, add 1 chopped onion and 3 minced garlic cloves. Cook over medium heat until soft and golden, about 5 minutes.

  3. 3

    Stir in 2 tbsp tomato paste and 2 tbsp peanut butter. Cook for 1 minute, stirring constantly, until fragrant and well combined.

  4. 4

    Pour in the 1 can coconut milk and bring to a gentle simmer. Cook, stirring occasionally, until the sauce thickens slightly, about 5 minutes. Season with salt and pepper to taste.

  5. 5

    Return the cooked shrimp to the skillet. Simmer for 2 minutes, until heated through. The sauce should be creamy and coat the shrimp.

  6. 6

    Stir in 2 tbsp chopped parsley and serve hot over rice or with crusty bread.

Tools you’ll need

  • Large skillet
  • Wooden spoon
  • Knife
  • Cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.