Custrd is out on the App Store — Download it free →
Back to recipes

Shrimp Nigiri

A simple homemade shrimp nigiri with seasoned rice, topped with tender shrimp and served with wasabi and pickled ginger. Perfect for a quick sushi fix at home.

Total time
25 min
Servings
2
Calories
350
Protein
18g
Shrimp Nigiri
comfortingsatisfyingJapanesedairy-freeshrimptenderstickyweeknight dinner

Ingredients

  • 1 cup sushi rice
  • 1.25 cups water
  • 2 tbsp rice vinegar
  • 1 tsp sugar
  • ½ tsp salt
  • 8 large cooked shrimp

Instructions

  1. 1

    Rinse the 1 cup sushi rice in cold water until the water runs clear, then drain well.

  2. 2

    Combine the rice and 1.25 cups water in a saucepan. Bring to a boil, then cover, reduce heat to low, and simmer until the water is absorbed and the rice is tender, about 15 minutes.

  3. 3

    In a small bowl, mix the 2 tbsp rice vinegar, 1 tsp sugar, and 0.5 tsp salt until dissolved. Fold this into the hot rice and let it cool to room temperature.

  4. 4

    Wet your hands with water, then shape about 2 tbsp of rice into a small oval. Place one cooked shrimp on top and press gently to secure.

  5. 5

    Serve the nigiri with wasabi and pickled ginger on the side, if desired.

Tools you’ll need

  • saucepan with lid
  • mixing bowl
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.