Custrd is out on the App Store — Download it free →
Back to recipes

Shrimp in Coconut Milk Stew

A quick, creamy Brazilian-inspired stew with shrimp, coconut milk, and a hint of spice. Ready in about 20 minutes, perfect for a weeknight dinner.

Total time
20 min
Servings
4
Calories
350
Protein
25g
Shrimp in Coconut Milk Stew
comfortingquickBraziliangluten-freeshrimpcreamytenderweeknight

Ingredients

  • 1 lb shrimp, peeled and deveined
  • 1 can (13.5 oz) coconut milk
  • 1 medium onion, chopped
  • 1 medium tomato, chopped
  • 2 tbsp cassava flour (or all-purpose flour)
  • 2 tbsp olive oil

Instructions

  1. 1

    Season the 1 lb shrimp with salt and pepper. Heat 2 tbsp olive oil in a large skillet over medium-high heat until shimmering, about 2 minutes.

  2. 2

    Add the shrimp in a single layer and cook until pink and opaque, about 2 minutes per side. Transfer to a plate and set aside.

  3. 3

    In the same skillet, add the 1 chopped onion and 1 chopped tomato. Cook over medium heat until soft and fragrant, about 5 minutes.

  4. 4

    Stir in the 2 tbsp cassava flour and cook for 1 minute, stirring constantly. Pour in the 1 can coconut milk and bring to a gentle simmer, stirring until slightly thickened, about 3 minutes.

  5. 5

    Return the shrimp to the skillet and simmer for 2 minutes until heated through. Taste and adjust salt and pepper. Serve hot with rice or bread.

Tools you’ll need

  • Large skillet
  • Cutting board
  • Knife
  • Wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.