CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Shrimp Ankake Yakisoba

Crispy fried noodles topped with tender shrimp in a silky, savory sauce. This one-pan weeknight dinner comes together in under 20 minutes with minimal cleanup.

Total time
18 min
Servings
2
Calories
410
Protein
18g
20-Min Shrimp Ankake Yakisoba
quicksatisfyingjapaneseshrimpcrispysilkyweeknightnoodle

Ingredients

  • 2 packages instant yakisoba noodles
  • 10 oz shrimp, peeled and deveined
  • ½ medium yellow onion, thinly sliced
  • 3 tbsp soy sauce
  • 1.5 tbsp cornstarch
  • ¾ cup water

Instructions

  1. 1

    Cook yakisoba noodles in boiling water for 3 minutes until tender, then drain and pat dry.

  2. 2

    Heat 2 tbsp neutral oil in a large skillet over medium-high until shimmering, about 1 minute.

  3. 3

    Spread noodles flat in the skillet and let cook undisturbed for 3–4 minutes until edges crisp and golden.

  4. 4

    Push noodles to the side; add shrimp and onion to the open space and cook for 2 minutes until shrimp start to pink.

  5. 5

    Whisk soy sauce, cornstarch, and water together, then pour over noodles and shrimp.

  6. 6

    Toss everything together and cook for 1–2 minutes until sauce thickens and coats the noodles.

Tools you’ll need

  • large skillet (12-inch)
  • pot for boiling
  • small bowl or measuring cup
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Japanese recipes →