CookSnap is coming soon — Join the waitlist →

15-Min Shio Ramen with Shrimp

Light, salty broth with tender shrimp and a soft-boiled egg over ramen noodles. Fresh and done in 15 minutes—no long simmer required.

Total time
15 min
Servings
2
Calories
380
Protein
26g
15-Min Shio Ramen with Shrimp
freshlightjapaneseshrimptenderspringyweeknightsoup

Ingredients

  • ½ lb shrimp, peeled and deveined
  • 7 oz ramen noodles (fresh or dried)
  • 4 cups dashi broth or seafood stock
  • 2 tbsp soy sauce
  • 1 tbsp mirin
  • 2 whole eggs
  • 2 stalks scallions, thinly sliced

Instructions

  1. 1

    Bring a small pot of water to a boil. Lower eggs into the water; boil exactly 6 minutes for jammy yolks.

  2. 2

    In a separate large pot, heat dashi over medium-high until steaming. Add soy sauce and mirin; stir to combine.

  3. 3

    Add shrimp to the broth. Cook without stirring for 90 seconds until shrimp edges curl and turn opaque.

  4. 4

    Add ramen noodles to the same pot. Boil until al dente, per package directions (usually 3–4 minutes).

  5. 5

    Transfer eggs to an ice bath for 30 seconds, then peel and halve. Divide noodles and broth between two bowls.

  6. 6

    Top each bowl with one halved egg and a pinch of scallions. Serve immediately.

Tools you’ll need

  • small pot
  • large pot
  • spoon
  • bowl
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.