CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Seafood Pho

Quick Vietnamese seafood noodle soup with shrimp, squid, and rice noodles in a fragrant broth base. Ready in 20 minutes with bold anise and lime flavors.

Total time
20 min
Servings
2
Calories
320
Protein
28g
20-Min Seafood Pho
freshlightvietnameseshrimptenderchewyweeknightsoup

Ingredients

  • ½ lb shrimp, large (peeled and deveined)
  • ¼ lb squid, cleaned and sliced into rings
  • 6 cups chicken or seafood broth
  • 6 oz rice noodles (dried, 1/8-inch wide)
  • 2 whole star anise
  • 1 whole lime (juiced) + fish sauce to taste

Instructions

  1. 1

    Bring broth to a rolling boil in a large pot. Add star anise and simmer for 2 minutes until fragrant.

  2. 2

    Add rice noodles and cook according to package directions until tender, usually 4–5 minutes.

  3. 3

    Add shrimp and squid, stirring gently. Cook until shrimp is opaque and squid is tender, about 2 minutes.

  4. 4

    Squeeze lime juice over the pot. Stir in fish sauce to taste (start with 1 tbsp and adjust).

  5. 5

    Ladle soup into bowls. Serve hot with extra lime wedges and fresh herbs (basil, cilantro, mint) if available.

Tools you’ll need

  • large pot (6-quart minimum)
  • wooden spoon or ladle
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.