CookSnap is coming soon — Join the waitlist →
Back to recipes

Sheet Pan Gnocchi with Roasted Vegetables

Pillowy gnocchi and colorful vegetables roast together on one pan with garlic and olive oil until golden and caramelized. A simple, hands-off dinner that tastes restaurant-quality.

Total time
30 min
Servings
4
Calories
285
Protein
8g
Sheet Pan Gnocchi with Roasted Vegetables
comfortsimpleitalianvegetariancrispytenderweeknightpasta

Ingredients

  • 1.5 lbs gnocchi, refrigerated or frozen
  • 1 medium zucchini, cut into 1-inch pieces
  • 12 oz cherry tomatoes
  • ½ medium red onion, cut into 1-inch chunks
  • 4 cloves garlic cloves, smashed
  • 4 tbsp olive oil

Instructions

  1. 1

    Preheat oven to 425°F. Line a large sheet pan with parchment paper.

  2. 2

    Spread gnocchi, zucchini, tomatoes, onion, and garlic on the sheet pan.

  3. 3

    Drizzle with olive oil and season generously with salt and pepper.

  4. 4

    Toss everything until coated, then spread in a single layer.

  5. 5

    Roast until gnocchi is golden and vegetables are tender, 20–22 minutes.

  6. 6

    Remove from oven. Taste and adjust salt and pepper. Serve warm.

Tools you’ll need

  • large sheet pan
  • parchment paper
  • large spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.