Custrd is out on the App Store — Download it free →
Back to recipes

Garlic Butter Hilopites with Spinach

Crispy pan-toasted Greek pasta with wilted spinach, finished with garlic butter and crumbly feta. Ready in 15 minutes — the kind of weeknight dinner that tastes way better than it should.

Total time
15 min
Servings
2
Calories
410
Protein
12g
Garlic Butter Hilopites with Spinach
comfortsimplegreekmediterraneanvegetariancheesecrispytender

Ingredients

  • 1.5 cups hilopites (Greek pasta)
  • 3 tbsp butter
  • 3 cloves garlic, minced
  • 2 cups fresh spinach, loosely packed
  • ½ cup feta cheese, crumbled
  • ½ whole lemon (juiced)

Instructions

  1. 1

    Heat a large skillet over medium-high heat. Add hilopites and cook, stirring constantly, until toasted and golden, ~5 minutes.

  2. 2

    Add butter and minced garlic. Stir constantly until fragrant, about 30 seconds — don't let the garlic brown.

  3. 3

    Add 1.5 cups water and a pinch of salt. Bring to a simmer and cook uncovered until pasta is tender and water mostly absorbs, ~4 minutes.

  4. 4

    Pile spinach on top of the pasta and stir until just wilted, about 60 seconds.

  5. 5

    Remove from heat. Squeeze lemon juice over the top and stir gently to combine.

  6. 6

    Divide between bowls and scatter feta over each serving. Serve immediately.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon or spatula
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.