CookSnap is coming soon — Join the waitlist →

15-Min Shakshuka with Crispy Bread

Eggs baked into a quick tomato sauce spiked with garlic and cumin, topped with crispy bread for dipping. One skillet, total hands-on time under 10 minutes.

Total time
15 min
Servings
2
Calories
285
Protein
12g
15-Min Shakshuka with Crispy Bread
comfortsimplemiddle-easternvegetarianeggscreamycrispyweeknight

Ingredients

  • 2 tbsp olive oil
  • 3 cloves garlic, minced
  • 1 can (14 oz) canned crushed tomatoes
  • ½ tsp cumin
  • 4 large eggs
  • 2 slices sliced bread

Instructions

  1. 1

    Heat olive oil in a 10-inch skillet over medium-high until shimmering, about 1 minute.

  2. 2

    Add garlic and cook for 30 seconds until fragrant, then add crushed tomatoes and cumin.

  3. 3

    Simmer the sauce for 3 minutes, stirring once. Season with salt and pepper to taste.

  4. 4

    Make 4 small wells in the sauce and crack an egg into each, spacing them evenly.

  5. 5

    Cover the skillet and cook for 3–4 minutes until egg whites set but yolks still jiggle slightly.

  6. 6

    Toast the bread slices in a dry skillet or toaster until golden and crispy, about 2 minutes.

  7. 7

    Slide the skillet off heat. Serve shakshuka hot with crispy bread for dipping.

Tools you’ll need

  • 10-inch skillet with lid
  • toaster or second skillet

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.