CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Seafood Shio Ramen

Clean, salty broth built on anchovy and kelp, topped with tender noodles, shrimp, and a soft-boiled egg. Ready in 20 minutes with a shortcut broth base that skips the 8-hour simmer.

Total time
20 min
Servings
2
Calories
380
Protein
24g
20-Min Seafood Shio Ramen
comfortsimplejapaneseshrimptendersilkyweeknightdinner

Ingredients

  • 6 cups water
  • 1 piece (4×2 inch) kombu (dried kelp)
  • 1 tbsp anchovy paste or miso paste
  • 8 oz large shrimp, peeled and deveined
  • 7 oz fresh ramen noodles or dried (1.5mm)
  • 2 large eggs
  • 2 stalks scallions, white and green parts separated, sliced thin

Instructions

  1. 1

    Bring water to a boil in a large pot. Add kombu and immediately remove from heat; let sit 3 minutes, then remove kombu.

  2. 2

    Return broth to a boil. Whisk in anchovy paste (or miso) until dissolved. The broth should taste clean and salty.

  3. 3

    Add shrimp and simmer until opaque, 2–3 minutes. Remove with a slotted spoon and set aside.

  4. 4

    Gently add eggs to the simmering broth. Set a timer for 6 minutes for soft-boiled yolks; remove with a spoon.

  5. 5

    Add noodles to the same pot and cook until al dente, 3–4 minutes for fresh, 4–5 for dried. Stir gently to avoid clumping.

  6. 6

    Divide noodles and broth between two bowls. Top each with shrimp, a halved egg, and scallions. Serve immediately.

Tools you’ll need

  • large pot (5-quart or larger)
  • wooden spoon or chopsticks
  • slotted spoon
  • two soup bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.