CookSnap is coming soon — Join the waitlist →
Back to recipes

Quick Shio Ramen with Shrimp

A light, salty broth-based ramen loaded with tender shrimp and fresh scallions, ready in under 25 minutes. This stripped-down version captures the essence of traditional shio ramen without specialty ingredients.

Total time
24 min
Servings
2
Calories
385
Protein
26g
Quick Shio Ramen with Shrimp
comfortsimplejapaneseshrimptenderchewyweeknightsoup

Ingredients

  • ½ lb shrimp, large, peeled and deveined
  • 8 oz ramen noodles (fresh or dried)
  • 5 cups chicken or seafood stock
  • 2 tablespoons soy sauce
  • ½ teaspoon salt
  • 2 whole scallions, green parts only, sliced thin

Instructions

  1. 1

    Pour the 5 cups of stock into a large pot and place it over high heat, uncovered, until you see large bubbles breaking the surface vigorously, about 5 minutes.

  2. 2

    Stir 2 tablespoons of soy sauce and 0.5 teaspoon of salt into the hot broth until the salt dissolves completely and you cannot see any grains at the bottom.

  3. 3

    Add the ramen noodles to the broth, spreading them apart with a wooden spoon as they soften, and let them cook at a rolling boil until tender, about 3 minutes for fresh or 4 for dried.

  4. 4

    Place the shrimp gently into the pot and stir once, then wait until the shrimp turn opaque pink and curl into a C shape, about 2 to 3 minutes — this means they are cooked through.

  5. 5

    Pour the noodles, shrimp, and broth into two bowls, dividing evenly between them by holding a spoon over each bowl to guide the noodles.

  6. 6

    Scatter the sliced scallion greens over the top of each bowl in a small pile, then serve immediately while the broth is still steaming hot.

Tools you’ll need

  • large pot (4-quart or bigger)
  • wooden spoon
  • two bowls
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.