CookSnap is coming soon — Join the waitlist →

Sate Lilit — Crispy Fish Satay with Sambal

Minced fish mixed with coconut and spices, wrapped around skewers and pan-fried until golden. Served with chicken satay, sambal matah, sambal ulek, and plecing kangkung for a complete Balinese spread.

Total time
25 min
Servings
2
Calories
285
Protein
28g
Sate Lilit — Crispy Fish Satay with Sambal
satisfyingrusticindonesianfishcrispytenderweeknightdinner

Ingredients

  • 350 g minced white fish (snapper, halibut, or cod)
  • ½ cup grated coconut (fresh or unsweetened dried)
  • 2 whole shallots, minced
  • 2 cloves garlic, minced
  • 1 tbsp ginger, minced
  • 1 whole lime (zested + juiced)
  • 3 tbsp coconut oil or vegetable oil

Instructions

  1. 1

    Soak 8 wooden skewers in water for 10 minutes while you prep.

  2. 2

    Combine minced fish, coconut, shallots, garlic, ginger, lime zest, and juice in a bowl with a big pinch of salt.

  3. 3

    Knead the mixture with your hands until it holds together, then mold around the soaked skewers in a thin, flat spiral.

  4. 4

    Heat oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  5. 5

    Pan-fry the sate 2–3 minutes per side until edges are golden-brown and the surface looks set.

  6. 6

    Serve hot with sambal matah, sambal ulek, plecing kangkung, and grilled chicken sate on the side.

Tools you’ll need

  • 8 wooden skewers
  • large skillet or frying pan (10-inch minimum)
  • mixing bowl
  • microplane or fine grater

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.