CookSnap is coming soon — Join the waitlist →
Back to recipes

Salmon Temaki Hand Rolls

Crispy nori cones filled with fresh sushi rice, raw salmon, and cucumber—ready to assemble and eat in minutes. No rolling mat or special skills required.

Total time
20 min
Servings
2
Calories
285
Protein
18g
Salmon Temaki Hand Rolls
freshelegantjapanesesalmoncrispycreamyweeknightdate-night

Ingredients

  • 2 cups sushi rice, cooked and cooled
  • 4 sheets nori sheets (seaweed)
  • 6 ounces salmon, sushi-grade
  • ½ whole cucumber
  • 1 tablespoon rice vinegar
  • 0 to taste salt and pepper

Instructions

  1. 1

    Season the cooled sushi rice by drizzling it with 1 tablespoon of rice vinegar, then gently folding the vinegar in using a rubber spatula until evenly distributed, about 1 minute.

  2. 2

    Pat the salmon completely dry with paper towels, then slice it against the grain (lengthwise along the natural striations in the flesh) into strips roughly 1/4-inch thick and 3 inches long.

  3. 3

    Place the cucumber on the cutting board and slice it lengthwise from tip to tip into 1/8-inch-thick planks, then cut each plank into matchstick-sized pieces about 1/8-inch wide and 3 inches long.

  4. 4

    Cut each nori sheet in half horizontally with a clean, straight knife to create 8 smaller rectangles.

  5. 5

    Lay one nori rectangle on a flat surface, shiny side down and short edge closest to you.

  6. 6

    Spread 2 tablespoons of sushi rice across the center of the nori in a thin diagonal stripe.

  7. 7

    Arrange one salmon strip and a small handful of cucumber matchsticks on top of the rice.

  8. 8

    Roll the nori into a cone shape by lifting the bottom-left corner and folding it toward the top-right, then continue rolling upward to form a tight cone with the seam on the side.

  9. 9

    Repeat steps 5 through 8 with the remaining 7 nori rectangles.

  10. 10

    Arrange the completed hand rolls on a serving plate, seam-side down, and serve immediately with soy sauce, wasabi, and pickled ginger on the side if desired.

Tools you’ll need

  • cutting board
  • sharp knife
  • paper towels
  • rubber spatula
  • small serving plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.