Custrd is out on the App Store — Download it free →
Back to recipes

25-Min Saffron Chicken & Rice

Crispy chicken thighs and saffron rice cooked in one skillet—no fancy paella pan required. Finish with lime for brightness and serve straight from the pan.

Total time
25 min
Servings
4
Calories
545
Protein
38g
25-Min Saffron Chicken & Rice
comfortsimplespanishchickencrispytenderfluffyweeknight

Ingredients

  • 1.5 lbs chicken thighs, boneless
  • 1.5 cups short-grain white rice
  • 1 whole red bell pepper
  • ½ whole yellow onion
  • ¼ tsp saffron threads
  • 3 cups chicken broth
  • ½ tsp smoked paprika
  • 1 whole lime

Instructions

  1. 1

    Pat chicken dry and season with salt and pepper. Slice onion and bell pepper into thin strips.

  2. 2

    Heat 2 tbsp oil in a large skillet over medium-high until shimmering. Sear chicken 3 minutes per side until golden.

  3. 3

    Remove chicken and set aside. Add onion and bell pepper to the pan, cook 2 minutes until softened.

  4. 4

    Stir in rice, coating with oil, for 90 seconds until edges look translucent. Add saffron, paprika, and broth.

  5. 5

    Nestle chicken back into the rice. Bring to a boil, then reduce heat to low, cover, and cook 12 minutes until rice is tender and liquid is absorbed.

  6. 6

    Cut lime into wedges. Serve paella directly from the skillet with lime wedges on the side.

Tools you’ll need

  • large skillet (12-inch cast iron or stainless steel)
  • sharp knife
  • wooden spoon
  • lid or foil for skillet

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.