CookSnap is coming soon — Join the waitlist →
Back to recipes

25-Min Rogal Świętomarcinski (Poznań Croissant)

Buttery puff pastry swirled with caramelized onions and mushrooms, baked until golden and crispy. A TikTok-friendly version of Poznań's iconic pastry—skip the lamination, use store-bought dough, and you've got a show-stopping dinner.

Total time
25 min
Servings
2
Calories
520
Protein
14g
25-Min Rogal Świętomarcinski (Poznań Croissant)
elegantcomfortpolishvegetarianvegetariancrispyflakytender

Ingredients

  • 1 package (2 sheets, thawed) frozen puff pastry sheets
  • 2 whole yellow onions, large
  • 8 oz mushrooms, cremini or button
  • 3 tbsp butter
  • ¾ cup gruyère or aged cheddar, grated
  • 1 tbsp fresh thyme leaves
  • 1 whole (for egg wash) egg
  • 1 tsp caraway seeds (optional)

Instructions

  1. 1

    Slice onions into thin half-moons. Slice mushrooms 1/4-inch thick.

  2. 2

    Heat butter in a large skillet over medium. Add onions and cook, stirring occasionally, until golden and soft, ~12 minutes. Season with salt and pepper.

  3. 3

    Add mushrooms and thyme to the skillet. Cook 3 minutes until mushrooms release liquid and edges brown. Remove from heat and cool slightly, ~2 minutes.

  4. 4

    Lay a pastry sheet on a parchment-lined sheet pan. Spread the onion-mushroom mixture evenly over it, leaving 1/2 inch at the edges.

  5. 5

    Sprinkle cheese over the filling. Roll the pastry tightly into a log, then coil it into a spiral. Tuck the end underneath.

  6. 6

    Whisk the egg with 1 tbsp water. Brush the spiral with egg wash and sprinkle with caraway seeds if using.

  7. 7

    Bake at 400°F until deep golden brown, ~10 minutes. Let cool 2 minutes before slicing into wedges.

Tools you’ll need

  • chef's knife
  • large skillet
  • sheet pan
  • parchment paper
  • small bowl (for egg wash)
  • whisk
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.