CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Ravioli with Ricotta and Brown Butter

Store-bought ravioli filled with creamy ricotta, finished with nutty brown butter and fresh sage. Dinner ready in 15 minutes.

Total time
15 min
Servings
2
Calories
520
Protein
18g
Ravioli with Ricotta and Brown Butter
comfortsimpleitalianvegetarianvegetariantendercreamyweeknight

Ingredients

  • 1 pound store-bought cheese ravioli
  • 4 tablespoons butter
  • 8 leaves fresh sage leaves
  • 1 whole garlic clove, peeled
  • 1 teaspoon salt
  • ¼ teaspoon black pepper

Instructions

  1. 1

    Fill a large pot with water and set it over high heat until the water reaches a rolling boil with large, continuous bubbles breaking the surface, about 8 minutes.

  2. 2

    While the water heats, place the butter in a small skillet over medium-low heat and add the garlic clove and sage leaves to the cold butter.

  3. 3

    Cook the butter over medium-low heat without stirring for 6–7 minutes, watching until the milk solids at the bottom turn golden brown and smell nutty and toasted.

  4. 4

    Once the water boils, add 1 teaspoon of salt, then carefully place the ravioli into the pot so they don't stick to the bottom.

  5. 5

    Stir the ravioli gently once with a wooden spoon, then cook for 3–4 minutes until the ravioli float to the surface and stay there for 30 seconds.

  6. 6

    Remove the garlic clove and sage leaves from the brown butter skillet using a slotted spoon.

  7. 7

    Using a slotted spoon, transfer the cooked ravioli directly from the pot to the skillet with the brown butter, leaving pasta water behind.

  8. 8

    Tilt the skillet gently so the brown butter coats all the ravioli, then sprinkle with 0.25 teaspoon black pepper.

  9. 9

    Divide the ravioli and brown butter between two plates, then top each with a small piece of the cooked sage leaf and the reserved cooked garlic clove if desired.

Tools you’ll need

  • large pot (at least 3-quart capacity)
  • small skillet (8–10 inches)
  • wooden spoon
  • slotted spoon
  • two serving plates

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.