CookSnap is coming soon — Join the waitlist →

Quick Veggie Tart with Red Pepper Sauce

Crispy phyllo shell loaded with sautéed zucchini, bell peppers, and onions, finished with melted cheese. Served with bright red pepper sauce and a fresh tomato-lettuce salad for a complete Argentine-inspired dinner.

Total time
20 min
Servings
2
Calories
420
Protein
14g
Quick Veggie Tart with Red Pepper Sauce
casualwholesomeargentinianvegetariancheesecrispytenderweeknight

Ingredients

  • 6 sheets frozen phyllo dough (thawed)
  • 1 medium zucchini, sliced into half-moons
  • 1 medium bell pepper (red or yellow), chopped
  • ½ medium yellow onion, thinly sliced
  • 1 cup shredded mozzarella or cheddar
  • ¾ cup roasted red peppers (jarred), plus 2 tbsp liquid
  • 2 servings fresh tomato and lettuce (for serving)

Instructions

  1. 1

    Heat 2 tbsp olive oil in a 10-inch skillet over medium-high. Add onion and cook until soft, about 3 minutes.

  2. 2

    Add zucchini and bell pepper, stirring occasionally, until tender and lightly golden, about 5 minutes.

  3. 3

    Layer 3 phyllo sheets in a baking dish, brushing each with olive oil. Spread veggie mixture on top, then layer remaining 3 phyllo sheets with oil between each.

  4. 4

    Sprinkle cheese over the top phyllo. Bake at 400°F until the crust is golden and crispy, about 8 minutes.

  5. 5

    Blitz jarred red peppers with their liquid, salt, and pepper in a blender until smooth. Transfer to a small bowl.

  6. 6

    Slice the tart into wedges. Serve with red pepper sauce alongside fresh tomato and lettuce salad.

Tools you’ll need

  • 10-inch skillet
  • 9x13-inch baking dish
  • blender
  • knife and cutting board
  • brush for oil

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.