CookSnap is coming soon — Join the waitlist →
Back to recipes

Quick Hu Tieu Mi

Vietnamese mixed noodle soup with shrimp and pork in a fragrant broth, ready in under 30 minutes. A light, satisfying weeknight dinner that balances savory, tangy, and fresh flavors.

Total time
25 min
Servings
2
Calories
285
Protein
28g
Quick Hu Tieu Mi
lightsatisfyingvietnameseshrimpporktenderchewyweeknight

Ingredients

  • 4 cups chicken or pork broth
  • 1.5 tablespoons tamarind paste or lime juice
  • 1 tablespoon fish sauce
  • 6 ounces medium shrimp, peeled and deveined
  • 6 ounces thinly sliced cooked pork (or rotisserie chicken)
  • 4 ounces rice noodles or egg noodles, broken into 2-inch pieces
  • ¼ cup fresh herbs (cilantro, green onion), chopped

Instructions

  1. 1

    Pour the broth into a large pot and bring it to a boil over high heat, about 5 minutes. You will see large bubbles rapidly breaking on the surface.

  2. 2

    Add the tamarind paste and fish sauce to the boiling broth, stirring for 30 seconds until dissolved. The broth should smell sour and savory.

  3. 3

    Add the noodles and stir once with a wooden spoon to separate them, about 15 seconds. Return the broth to a boil.

  4. 4

    Cook the noodles at a rolling boil for 5 minutes, stirring once halfway through, until they are tender but still slightly firm when you bite one.

  5. 5

    Add the shrimp and cooked pork to the pot and stir once. Cook at a medium boil for 3 minutes until the shrimp are firm and pink on all sides.

  6. 6

    Pour the soup into two bowls, dividing the noodles, shrimp, and pork evenly between them.

  7. 7

    Scatter the chopped herbs over the top of each bowl and serve immediately while hot.

Tools you’ll need

  • large pot (4-quart or larger)
  • wooden spoon
  • two soup bowls
  • ladle

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.