CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Whole Fish with Garlic & Calamansi

Whole fish fried golden and crackling, finished with a sharp garlic-calamansi punch. Classic Filipino dinner that tastes restaurant-perfect in 15 minutes.

Total time
15 min
Servings
2
Calories
385
Protein
32g
Crispy Whole Fish with Garlic & Calamansi
casualsatisfyingfilipinofishcrispytenderweeknightdinner

Ingredients

  • 1 fish (1–1.5 lbs) whole white fish (milkfish or tilapia), cleaned and patted dry
  • 4 cloves garlic cloves, minced
  • 2 whole calamansi, halved (or lime)
  • ¼ cup all-purpose flour
  • ½ cup neutral cooking oil
  • 2 tbsp fish sauce

Instructions

  1. 1

    Season fish inside and out with salt and pepper. Dust both sides lightly with flour.

  2. 2

    Heat oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  3. 3

    Carefully slide fish into hot oil. Fry without moving for 5–6 minutes until skin is golden and crisp.

  4. 4

    Flip fish gently. Fry the other side 4–5 minutes until golden and flesh flakes easily.

  5. 5

    Transfer fish to a plate. Pour off all but 1 tbsp oil. Add minced garlic and cook 30 seconds until fragrant.

  6. 6

    Drizzle fish with fish sauce and squeeze calamansi over top. Serve immediately with the garlic oil.

Tools you’ll need

  • large skillet (12-inch)
  • paper towels
  • spatula or fish turner

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.