CookSnap is coming soon — Join the waitlist →

Potato & Mushroom Pierogi

Tender dough pillows filled with creamy mashed potatoes and earthy sautéed mushrooms, boiled until they float, then pan-fried until golden. A comforting Polish classic.

Total time
50 min
Servings
4
Calories
485
Protein
12g
Potato & Mushroom Pierogi
comfortcozypolishvegetarianvegetariantendercreamyweeknight

Ingredients

  • 2 cups all-purpose flour
  • 2 large eggs
  • ¼ cup sour cream
  • 1.5 lbs potatoes, russet
  • 10 oz mushrooms, mixed
  • 4 tbsp butter
  • ½ cup caramelized onions or sour cream

Instructions

  1. 1

    Peel potatoes and cut into 1-inch chunks. Boil in salted water until fork-tender, ~15 minutes.

  2. 2

    Slice mushrooms into quarters. Sauté in 1 tbsp butter over medium-high until liquid evaporates, ~8 minutes.

  3. 3

    Drain potatoes. Mash with remaining 3 tbsp butter and salt. Fold in cooled mushrooms.

  4. 4

    Mix flour and 0.5 tsp salt in a bowl. Make a well; add eggs and sour cream.

  5. 5

    Stir with a fork until a shaggy dough forms. Knead on a floured counter until smooth, ~3 minutes.

  6. 6

    Roll dough to 1/8-inch thickness. Cut 3-inch circles with a cup. Place 1 tbsp filling on each.

  7. 7

    Fold circle in half. Pinch edges firmly to seal, removing air pockets. Lay on a floured surface.

  8. 8

    Bring a large pot of salted water to a boil. Drop pierogi in batches; cook until they float, then 2 minutes more.

  9. 9

    Remove with a slotted spoon. Pan-fry in 2 tbsp butter over medium-high until golden edges, ~3 minutes per side.

  10. 10

    Serve hot topped with caramelized onions or a dollop of sour cream.

Tools you’ll need

  • large pot
  • 12-inch skillet
  • mixing bowl
  • fork
  • rolling pin
  • 3-inch cup or round cutter
  • slotted spoon
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.