CookSnap is coming soon — Join the waitlist →
Back to recipes

Polish Potato & Cheese Pierogi with Caramelized Onions

Tender homemade dumplings filled with mashed potatoes and sharp cheddar, topped with sweet caramelized onions and sour cream. A comforting Polish classic that's easier than it looks.

Total time
50 min
Servings
4
Calories
485
Protein
14g
Polish Potato & Cheese Pierogi with Caramelized Onions
comfortnostalgicpolishvegetariancheesetendercreamyweeknight

Ingredients

  • 2 cups all-purpose flour
  • 1 whole egg
  • ½ tsp salt
  • 1 lb potatoes, peeled
  • 1 cup sharp cheddar cheese, shredded
  • 1 large yellow onion
  • 2 tbsp butter
  • ½ cup sour cream

Instructions

  1. 1

    Mix flour and salt in a bowl. Make a well in the center and crack in the egg.

  2. 2

    Gradually stir flour into the egg, then knead with your hands until a stiff dough forms, ~3 min.

  3. 3

    Cover dough and let rest at room temperature while you prepare filling.

  4. 4

    Cut potatoes into 2-inch chunks and boil in salted water until fork-tender, ~12 min.

  5. 5

    Drain potatoes and mash with a fork until smooth. Stir in cheese until melted.

  6. 6

    Slice onion into thin half-moons. Melt butter in a skillet over medium heat.

  7. 7

    Add onions and cook, stirring occasionally, until golden and very soft, ~15 min.

  8. 8

    Roll dough thin on a floured surface. Cut into 3-inch circles using a cup or cutter.

  9. 9

    Place 1 tbsp filling on each circle, fold in half, and press edges to seal tightly.

  10. 10

    Bring a large pot of salted water to a boil. Add pierogi in batches.

  11. 11

    Cook until pierogi float, then simmer 2 minutes more. Remove with a slotted spoon.

  12. 12

    Serve pierogi topped with caramelized onions and a dollop of sour cream.

Tools you’ll need

  • mixing bowl
  • fork
  • cutting board
  • chef's knife
  • 12-inch skillet
  • large pot
  • slotted spoon
  • measuring spoons
  • measuring cups
  • 3-inch round cutter or cup

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.