CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Polish Pierogi with Caramelized Onions

Tender potato-filled dumplings with crispy edges, topped with golden caramelized onions and sour cream. A comforting Polish classic that looks fancy but is surprisingly doable at home.

Total time
50 min
Servings
2
Calories
520
Protein
14g
Polish Pierogi with Caramelized Onions
comfortcozypolishvegetarianvegetariantendercrispyweeknight

Ingredients

  • 1.5 cups all-purpose flour
  • 1 whole egg
  • ¼ cup water
  • ½ teaspoon salt
  • 1 whole russet potato, medium
  • 1 whole yellow onion, large
  • 2 tablespoon butter
  • ½ cup sour cream

Instructions

  1. 1

    Pour 1.5 cups flour into a large mixing bowl, make a well in the center with your fingers, and crack the egg into it.

  2. 2

    Add 0.25 cup water and 0.5 teaspoon salt to the egg, then stir with a wooden spoon, gradually mixing flour from the sides until a shaggy dough forms.

  3. 3

    Dust your work surface with flour, place the dough on it, and knead by pressing with the heel of your hand, folding the dough back onto itself, and rotating a quarter turn; repeat for 8 minutes until the dough is smooth and elastic, not sticky.

  4. 4

    Cover the dough with a clean kitchen towel and let it rest at room temperature while you prepare the filling.

  5. 5

    Place the potato in a small pot, cover with cold water, set the pot on the stove over high heat, and bring to a boil.

  6. 6

    Reduce the heat to medium and simmer until a fork slides easily through the potato, about 12–15 minutes.

  7. 7

    Drain the potato in a colander, wait until cool enough to handle, then peel away the skin with your fingers or a small knife.

  8. 8

    Place the peeled potato in a small bowl and mash it with a fork until completely smooth with no lumps, then set aside.

  9. 9

    Place the large onion on a cutting board with the root end pointing away from you, slice off the papery skin and root end, then slice the onion lengthwise from top to bottom into thin half-moons, about 1/8 inch thick.

  10. 10

    Place a 12-inch skillet on the stove over medium heat, add 2 tablespoons butter, and once it melts and foams, add the sliced onion.

  11. 11

    Stir the onion with a wooden spoon once every 30 seconds, cooking until the edges turn deep golden brown, about 12–15 minutes; if it looks dry, add 1 tablespoon water.

  12. 12

    Taste a piece—it should be very soft and taste like caramel sugar. Pour the onion onto a plate and set aside.

  13. 13

    Dust your work surface with flour again, remove the dough from under the towel, and roll it into a flat disk about 1/8 inch thick using a rolling pin.

  14. 14

    Using a 3-inch round cookie cutter or the rim of a glass, cut circles from the dough; gather scraps, re-roll, and cut more until no dough remains.

  15. 15

    Place 1 heaping teaspoon of mashed potato in the center of each circle, fold the dough in half to create a half-moon, then press the curved edge firmly with your fingers to seal.

  16. 16

    Bring a large pot of salted water to a rolling boil over high heat—the water should bubble vigorously and steam should rise steadily.

  17. 17

    Gently lower the pierogi into the boiling water one at a time using a slotted spoon, wait until all of them float to the surface, then cook for 2 minutes more after the last one floats.

  18. 18

    Use a slotted spoon to lift each pierogi from the water and transfer it to a plate.

  19. 19

    Divide the pierogi between two bowls or plates, top with the caramelized onion, add a dollop of sour cream, and serve immediately.

Tools you’ll need

  • large mixing bowl
  • wooden spoon
  • work surface (cutting board or counter)
  • kitchen towel
  • small pot
  • colander
  • small bowl
  • fork (for mashing and sealing)
  • cutting board
  • chef's knife
  • 12-inch skillet
  • rolling pin
  • 3-inch round cookie cutter or glass
  • large pot
  • slotted spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.