CookSnap is coming soon — Join the waitlist →
Back to recipes

Potato Dumplings with Brown Butter

Pillowy pan-fried potato dumplings with crispy edges and a nutty brown butter sauce. A German comfort classic that tastes fancy but comes together in one skillet.

Total time
18 min
Servings
2
Calories
385
Protein
9g
Potato Dumplings with Brown Butter
comfortwholesomegermanvegetarianvegetariancrispytenderfluffy

Ingredients

  • 1 lb russet potatoes
  • ¾ cup all-purpose flour
  • 1 whole egg
  • 4 tbsp butter
  • 2 tbsp fresh parsley, chopped
  • ¼ tsp nutmeg, freshly grated

Instructions

  1. 1

    Boil potatoes in salted water until just fork-tender, about 10 minutes. Drain and let cool slightly, then peel and press through a ricer into a bowl.

  2. 2

    Fold flour, egg, nutmeg, salt, and pepper into potatoes until a soft dough forms. Divide into 8 balls, flatten slightly into thick patties.

  3. 3

    Heat 2 tbsp butter in a large skillet over medium-high. Pan-fry half the dumplings 3 minutes per side until edges turn golden and crispy.

  4. 4

    Transfer cooked dumplings to a plate. Add remaining 2 tbsp butter to the skillet and repeat with the second batch.

  5. 5

    Return all dumplings to the skillet. Lower heat to medium. Add butter to the pan and let it foam and brown, ~90 seconds, stirring gently to coat.

  6. 6

    Sprinkle parsley over the dumplings. Serve immediately while crispy and warm.

Tools you’ll need

  • large pot for boiling
  • ricer or masher
  • 12-inch skillet
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.