CookSnap is coming soon — Join the waitlist →

20-Min Pork & Cabbage Skillet

Juicy pork tenderloin seared until golden, then finished in a garlicky braised cabbage base with caraway and vinegar—the weeknight version of Polish kapuśniak that's ready in 20 minutes.

Total time
20 min
Servings
4
Calories
340
Protein
42g
20-Min Pork & Cabbage Skillet
comfortheartypolishporktendercrispyweeknightmain-dish

Ingredients

  • 1.25 lbs pork tenderloin, cut into 4 medallions (about 1 inch thick)
  • ¾ head green cabbage, thinly sliced
  • 1 tsp caraway seeds
  • 3 tbsp white vinegar
  • ¾ cup chicken broth
  • ½ tsp smoked paprika
  • 1 whole bay leaf
  • 1 medium yellow onion, thinly sliced

Instructions

  1. 1

    Pat pork dry with paper towels. Season both sides generously with salt and black pepper.

  2. 2

    Heat 2 tbsp olive oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  3. 3

    Sear pork 90 seconds per side without moving. Edges should be golden; center stays slightly pink. Transfer to a plate.

  4. 4

    Add onion to the same skillet and cook, stirring, until it softens and turns translucent, about 2 minutes.

  5. 5

    Add sliced cabbage, caraway seeds, paprika, and bay leaf. Stir constantly for 90 seconds until cabbage begins to wilt and smells fragrant.

  6. 6

    Pour in broth and vinegar, then nestle pork medallions into the cabbage. Cover and simmer 6 minutes until pork reaches 145°F internal temp.

  7. 7

    Uncover, taste, adjust salt and vinegar to your preference, then serve straight from the skillet.

Tools you’ll need

  • 12-inch stainless steel skillet with lid
  • instant-read meat thermometer
  • cutting board
  • chef's knife
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.