Custrd is out on the App Store — Download it free →
Back to recipes

Peruvian Aji De Gallina

A creamy, mildly spicy Peruvian chicken stew with a rich yellow sauce, topped with cheese and parsley. This simplified version is perfect for a weeknight dinner.

Total time
35 min
Servings
4
Calories
420
Protein
38g
Peruvian Aji De Gallina
comfortingPeruvianchickencreamyshreddedweeknightstewdinner

Ingredients

  • 1.5 lb chicken breast
  • 1 medium yellow onion
  • 2 cloves garlic
  • 3 tbsp aji amarillo paste
  • 2 slices bread slices
  • 1 cup evaporated milk
  • ½ cup parmesan cheese
  • 2 tbsp vegetable oil

Instructions

  1. 1

    Place the 1.5 lb chicken breast in a pot, cover with water, and simmer until cooked through, about 15 minutes. Reserve 1 cup of the broth, then shred the chicken.

  2. 2

    In a blender, combine the 2 bread slices (torn), 1 cup evaporated milk, and 1/2 cup parmesan cheese. Blend until smooth; set aside.

  3. 3

    Heat the 2 tbsp vegetable oil in a large skillet over medium heat. Add the 1 sliced onion and 2 minced garlic cloves; cook until soft and golden, about 5 minutes.

  4. 4

    Stir in the 3 tbsp aji amarillo paste and cook for 1 minute until fragrant.

  5. 5

    Add the shredded chicken and the reserved 1 cup broth. Simmer for 5 minutes, stirring occasionally.

  6. 6

    Pour in the blended bread-milk mixture and stir constantly until the sauce thickens and coats the chicken, about 3-4 minutes. Season with salt and pepper.

  7. 7

    Serve hot, garnished with chopped parsley and extra parmesan if desired.

Tools you’ll need

  • large pot
  • blender
  • large skillet
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.