Custrd is out on the App Store — Download it free →
Back to recipes

Pasta with Bacon and Cabbage

A cozy one-pot weeknight dinner: tender macaroni tossed with crispy bacon, sautéed cabbage, and a sprinkle of Parmesan. Simple, satisfying, and ready in about 30 minutes.

Total time
30 min
Servings
4
Calories
480
Protein
18g
Pasta with Bacon and Cabbage
comfortingItalian-Americanporkcreamycrispyweeknightpastadinner

Ingredients

  • 8 oz macaroni
  • 6 slices bacon
  • 4 cups green cabbage
  • 2 cloves garlic
  • ½ cup parmesan cheese
  • 1 tbsp olive oil
  • 1 tsp salt
  • ½ tsp black pepper

Instructions

  1. 1

    Bring a large pot of salted water to a boil. Add the 8 oz macaroni and cook until al dente, about 8-10 minutes. Reserve 1 cup of pasta water, then drain.

  2. 2

    While the pasta cooks, chop the 6 slices bacon into 1-inch pieces. Heat a large skillet over medium heat and cook the bacon until crispy, about 6-8 minutes. Transfer to a plate, leaving the drippings in the pan.

  3. 3

    Add the 1 tbsp olive oil to the skillet. Add the 4 cups shredded cabbage and 2 minced garlic cloves. Sauté over medium-high until the cabbage is tender and lightly browned, about 8-10 minutes.

  4. 4

    Return the bacon to the skillet. Add the drained macaroni and 1/2 cup of the reserved pasta water. Toss everything together over medium heat for 2-3 minutes, until the sauce coats the pasta.

  5. 5

    Remove from heat. Stir in the 1/2 cup grated Parmesan, 1 tsp salt, and 1/2 tsp black pepper. Add more pasta water if needed to loosen. Serve hot with extra Parmesan if desired.

  6. 6

    Optional: add a pinch of red pepper flakes or a squeeze of lemon for brightness.

  7. 7

    Serve immediately, garnished with extra black pepper or fresh herbs if you have them.

Tools you’ll need

  • Large pot
  • Large skillet
  • Colander
  • Measuring cups
  • Knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.