CookSnap is coming soon — Join the waitlist →

20-Min Pancit Canton with Crispy Noodles

Filipino stir-fried egg noodles loaded with crispy edges, fresh vegetables, and a savory soy-garlic finish. Ready in 20 minutes with just one skillet.

Total time
20 min
Servings
4
Calories
312
Protein
8g
20-Min Pancit Canton with Crispy Noodles
comfortcasualfilipinovegetarianvegetariancrispytenderweeknight

Ingredients

  • 12 oz dried egg noodles (pancit canton)
  • 3 tbsp neutral oil
  • 4 cloves garlic, minced
  • 2 medium carrots, cut into thin matchsticks
  • 3 cups cabbage, sliced into 1/4-inch ribbons
  • 3 tbsp soy sauce
  • 4 stalks scallions, chopped, plus extra for garnish

Instructions

  1. 1

    Boil noodles in salted water until just tender, about 4 minutes. Drain well.

  2. 2

    Heat oil in a large skillet over medium-high until it shimmers. Add garlic and cook 30 seconds until fragrant.

  3. 3

    Add carrots and cabbage. Stir-fry for 3 minutes until vegetables start to soften and edges brown.

  4. 4

    Add the noodles and soy sauce. Toss constantly for 2 minutes until noodles are coated and crispy edges form.

  5. 5

    Fold in most of the scallions. Serve immediately, garnish with remaining scallions and extra soy sauce if desired.

Tools you’ll need

  • large skillet or wok (12-inch)
  • pot for boiling
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.