CookSnap is coming soon — Join the waitlist →
Back to recipes

Palestinian Breakfast Platter

A vibrant, no-cook spread of hummus, labneh, fresh vegetables, olives, and warm pita — the classic Palestinian morning feast. Assemble in 10 minutes and serve family-style.

Total time
10 min
Servings
2
Calories
380
Protein
12g
Palestinian Breakfast Platter
freshwholesomecasualmiddle-easternvegetariancheesechickpeascreamy

Ingredients

  • 1 cup hummus
  • ¾ cup labneh (or thick Greek yogurt)
  • 1 medium cucumber, diced
  • 2 medium tomatoes, diced
  • ¾ cup Kalamata olives, pitted
  • ½ cup fresh parsley and mint, chopped
  • 4 pieces pita bread
  • 2 tbsp olive oil (for drizzle)

Instructions

  1. 1

    Spread hummus across a large plate, creating a shallow well in the center with the back of a spoon.

  2. 2

    Dollop labneh into the well and drizzle both with olive oil and a pinch of black pepper.

  3. 3

    Scatter cucumber, tomato, and olives around the plate in separate clusters.

  4. 4

    Sprinkle fresh parsley and mint over the entire platter.

  5. 5

    Warm pita in a dry skillet over medium heat 90 seconds per side, or wrap in a damp towel.

  6. 6

    Serve pita on the side. Tear and dip into hummus, labneh, and vegetables.

Tools you’ll need

  • large plate or platter
  • spoon
  • skillet (optional, for warming pita)
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.