CookSnap is coming soon — Join the waitlist →

Ovos Moles de Aveiro

Portuguese custard-filled pastry tubes with a crispy exterior and silky, sweet egg yolk filling. A traditional Aveiro delicacy that looks elegant but is surprisingly simple to assemble at home.

Total time
45 min
Servings
6
Calories
312
Protein
4g
Ovos Moles de Aveiro
elegantindulgentportuguesevegetariancrispycreamyflakyweekend

Ingredients

  • 1 lb (about 2 sheets) puff pastry sheets, thawed
  • 1 whole (for egg wash) egg yolk
  • 6 whole egg yolks
  • ¾ cup sugar
  • ¼ cup water
  • ½ tsp vanilla extract
  • 3 tbsp powdered sugar

Instructions

  1. 1

    Pour 0.25 cup water into a small saucepan and add 0.75 cup sugar, stirring until the sugar dissolves completely, about 2 minutes over medium heat.

  2. 2

    Remove the saucepan from heat and let the syrup cool to room temperature, about 5 minutes, so it is lukewarm when you add the yolks.

  3. 3

    Place 6 egg yolks in a medium bowl and pour the cooled syrup slowly into the yolks while whisking continuously, whisking the mixture until it is pale yellow and uniform, about 3 minutes.

  4. 4

    Stir 0.5 tsp vanilla extract into the custard mixture until fully combined.

  5. 5

    Set the oven to 400°F and wait for the indicator light to signal it has finished preheating, about 10 minutes.

  6. 6

    Unwrap the thawed puff pastry sheets and place one on a cutting board; using a sharp knife, cut the sheet lengthwise into 6 strips, each about 2 inches wide and 9 inches long.

  7. 7

    Wrap each pastry strip around a lightly oiled metal tube (or metal cream horn mold), overlapping the dough slightly so it adheres to itself, stretching gently as you wrap.

  8. 8

    Place the pastry-wrapped tubes seam-side down on a parchment-lined baking sheet, spacing them 1 inch apart.

  9. 9

    Whisk the remaining 1 egg yolk in a small bowl until uniform, then brush the entire outside surface of each pastry tube with the egg wash using a pastry brush.

  10. 10

    Bake the pastry tubes at 400°F until they are deep golden brown all over, about 18 to 22 minutes; they should sound crispy when you tap them lightly.

  11. 11

    Remove the baking sheet from the oven and let the tubes cool for 2 minutes until they are cool enough to handle, then carefully slide each tube off its metal mold.

  12. 12

    Transfer the custard to a piping bag fitted with a plain tip (or a zip-top bag with the corner snipped off).

  13. 13

    Hold each pastry tube upright and pipe the custard filling into the tube from the open end until it is full but not overflowing, using about 3 to 4 tablespoons per tube.

  14. 14

    Dust the top of each filled pastry tube generously with powdered sugar, using a fine sieve so the sugar distributes evenly.

  15. 15

    Serve the pastries immediately or within 2 hours, placing each one upright on a small dessert plate with a paper wrapper around the base if desired.

Tools you’ll need

  • small saucepan
  • medium mixing bowl
  • whisk
  • measuring cups and spoons
  • cutting board
  • sharp chef's knife
  • 6 metal cream horn molds or metal tubes (about 1.5 inches diameter, 4 inches long)
  • baking sheet
  • parchment paper
  • pastry brush
  • oven
  • piping bag with plain tip (or zip-top bag)
  • fine sieve or sifter

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.