One-Pot Chili Mac
Ground beef, elbow pasta, and canned chili meet in one skillet for a dinner that tastes like comfort and takes 20 minutes. Brown the beef, dump in the pasta and chili with water, and simmer until creamy.
- Total time
- 20 min
- Servings
- 4
- Calories
- 520
- Protein
- 32g
comfortamericanbeefcreamytenderweeknightpastadinner
Ingredients
- 1 lb ground beef
- 8 oz elbow macaroni
- 1 15-oz can canned chili (no beans or with beans, your call)
Instructions
- 1
Heat oil in a large skillet over medium-high until shimmering, about 90 seconds.
- 2
Add ground beef and cook, breaking it up with a spoon, until no pink remains, ~5 minutes.
- 3
Pour in the elbow pasta, canned chili, and 1 cup water, then stir to combine.
- 4
Bring to a simmer, then cook uncovered, stirring occasionally, until pasta is tender, ~8 minutes.
- 5
Season with salt and pepper to taste, then serve hot in bowls.
Tools you’ll need
- large skillet (12-inch or bigger)
- wooden spoon or spatula
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
