CookSnap is coming soon — Join the waitlist →
Back to recipes

Nasi Lemak Ayam Goreng — Coconut Rice & Crispy Chicken

Fragrant coconut rice paired with crispy fried chicken, hard-boiled egg, fried anchovies, peanuts, fresh cucumber, and fiery sambal. A complete Malaysian dinner in under 20 minutes.

Total time
18 min
Servings
2
Calories
720
Protein
48g
Nasi Lemak Ayam Goreng — Coconut Rice & Crispy Chicken
comfortsatisfyingmalaysianchickencrispytenderfluffyweeknight

Ingredients

  • 2 cups cooked jasmine rice
  • ½ cup coconut milk
  • 1 lb chicken thighs, boneless and skinless
  • ¼ cup sambal (store-bought or homemade)
  • 2 whole eggs
  • ¼ cup fried anchovies (ikan bilis)
  • ½ cup roasted peanuts (unsalted or lightly salted)

Instructions

  1. 1

    Boil 2 eggs in salted water until hard-boiled, about 10 minutes. Transfer to ice water while you start the chicken.

  2. 2

    Pat chicken thighs dry and season generously with salt and pepper. Heat 2 tbsp neutral oil in a large skillet over medium-high heat.

  3. 3

    Once oil shimmers, lay chicken skin-side down and sear without moving for 5 minutes until golden and crispy.

  4. 4

    Flip chicken and cook 4 more minutes until cooked through. Remove and set aside; keep the skillet and oil.

  5. 5

    Warm cooked rice with 0.5 cup coconut milk in the same skillet over low heat for 2 minutes, stirring gently to combine.

  6. 6

    Peel eggs, halve cucumber into slices. Plate coconut rice, top with chicken, egg, fried anchovies, peanuts, cucumber, and sambal.

Tools you’ll need

  • large skillet (12-inch)
  • tongs
  • small pot for boiling eggs
  • slotted spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Malaysian recipes →