CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Biryani Bowl with Crispy Chicken & Raita

Fragrant basmati rice layered with spiced fried chicken, creamy raita, and quick dal—all the biryani flavors in one pan, no 90-minute steam required. A complete weeknight dinner that tastes like a celebration.

Total time
20 min
Servings
2
Calories
580
Protein
42g
20-Min Biryani Bowl with Crispy Chicken & Raita
comfortsatisfyingmalaysianindianchickencrispyfluffycreamy

Ingredients

  • 2 cups cooked basmati rice (or store-bought biryani rice)
  • 1 lb chicken breasts, diced
  • 2 tbsp biryani or garam masala spice blend
  • ¾ cup plain yogurt (for raita)
  • ½ cup cucumber, finely diced
  • 1 cup cooked red lentils (dal)
  • ¼ cup cilantro (fresh, chopped)

Instructions

  1. 1

    Heat 2 tbsp oil in a large skillet over medium-high heat until it shimmers.

  2. 2

    Toss diced chicken with 1.5 tbsp biryani spice and a pinch of salt, then add to the skillet.

  3. 3

    Cook chicken, stirring occasionally, until golden and cooked through, about 8 minutes.

  4. 4

    Stir in cooked rice and dal, warming through for 2 minutes until fragrant.

  5. 5

    Mix yogurt with diced cucumber, remaining 0.5 tbsp spice, salt, and cilantro to make raita.

  6. 6

    Divide rice bowl between plates, dollop raita on top, and garnish with extra cilantro.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon or spatula
  • small bowl (for raita)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Malaysian recipes →